PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009599822.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Nin-like
Protein Properties Length: 971aa    MW: 106472 Da    PI: 6.2659
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009599822.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.53.1e-29565616152
          RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     aek+isle+l++yF++++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  XP_009599822.1 565 AEKTISLEVLQQYFAGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 616
                     589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.53555636IPR003035RWP-RK domain
PfamPF020423.3E-26568616IPR003035RWP-RK domain
SuperFamilySSF542771.08E-20875961No hitNo description
SMARTSM006666.1E-23876958IPR000270PB1 domain
PROSITE profilePS5174519.935876958IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.7E-22877957No hitNo description
CDDcd064078.87E-32877957No hitNo description
PfamPF005642.4E-16877957IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 971 aa     Download sequence    Send to blast
MLPGRLIRFS LQQRLFRLIL RRHFCLVLLF GDFPMISRKN LPEIHSPVLS VSPVTLDLVL  60
LVYTDDPEAT TETVSVNADK GRLPSPVLEL APRDYPNGSC IIKERMTQAL RYFKESTGER  120
VLAQVWAPVK DAGRYVLTTS GQPFVLDPDC NGLHQYRTVS LMYMFAADGE TGGVLGLPGR  180
VFRLKLPEWT PNVQYYSSKE FPRLDHALHY NVRGTLALPV FEPSGQSCLG VLELIMTSQK  240
INYAAEVDKV CKALETVNLK SSEILDHPNT QVYVMGYMNQ ICNEGRQNAL VEILEILTAV  300
CETYQLPLAQ TWVPCRHRSV LADGGGLKKS CSSFDGSCMG QICMSTTDVA FYVVDAHMWG  360
FREACAEHHL QKGQGVAGRA YASQKSCFCE DITQFCKTEY PLVHYARLFG LTSCFAICLR  420
SSHTGNDDYI LEFFLPPNSG DYSDQQALLN SLLLTMKQHF RSLSIASGGE LEHDWSSVEI  480
IKASIEEKID AKPESVSAPK SLPQPTRLPN GWTHLDPLGE QQFSVESDVA KGAGSKCGTG  540
EAPNHVSPSD NKPTGKKSER KRGKAEKTIS LEVLQQYFAG SLKDAAKSLG VCPTTMKRIC  600
RQHGISRWPS RKINKVNRSL SKLKCVIESV QGTEGAFTLT SLAPNSFPAA VGSISWPACA  660
SGSNLPSSPL SKPSVFPEEK NEFSNHGTPE SHEEAEPSNQ MLGGRVTRKE EFTPQNGFLY  720
AEGSHKSRTG SVSREESAGT PTSQGSCQGS PSAGNEFSPQ NDLVNSPARE ACMKAGGSLE  780
AAHQTTTENN LAAAFLIPRP FIPERAQEPF GGMLVEDAGS SHDLRNLCSA GEAQVDERVP  840
EYSLPNPPFS DAIAKDPVYV PADTTPQYSA WPEVTFVTIK AAYREDIIRF RLCLNSGIVK  900
LKEEVAKRLK LELGTFDIKY LDDDLEVVSI SCDADLQECV DISLSSGSSI VRLLVHDIMS  960
NLGSSCESSG K
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754470.0HG975447.1 Solanum pennellii chromosome ch08, complete genome.
GenBankHG9755200.0HG975520.1 Solanum lycopersicum chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009599822.10.0PREDICTED: protein NLP6-like isoform X3
SwissprotQ84TH90.0NLP7_ARATH; Protein NLP7
TrEMBLM1A4Z40.0M1A4Z4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000148370.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7